PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 224aa    MW: 25651.8 Da    PI: 8.5562
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098374.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601087.3e-349106198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++r+kC+++C+lap fp e++++f++vhk+FG+sn++k++ +l+ee+r++a++slv+eA +r++dPv G +g +++l ++l+  k++ +
  XP_011098374.1   9 ACASCKHQRKKCTEKCILAPFFPVEKTREFQAVHKVFGVSNLTKIIINLKEEDRKRAVDSLVWEALCRQKDPVLGPYGEYRRLCEELRLYKSQYQ 103
                     7***************************************************************************************9999987 PP

          DUF260  96 llk 98 
                     + +
  XP_011098374.1 104 QFH 106
                     766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4618109IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-329105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MQRMNCTSAC ASCKHQRKKC TEKCILAPFF PVEKTREFQA VHKVFGVSNL TKIIINLKEE  60
DRKRAVDSLV WEALCRQKDP VLGPYGEYRR LCEELRLYKS QYQQFHQVQA QGSLVYKAAA  120
QELMGWNNNK VMSINDEGIS NNNNTTNNFH SNGNNGVDFC PYAYSSHHIQ DTEKLRAERA  180
NGSALILPQH HLANSFSQQY FLTSGQYNRM DSKSVESTLW EGSS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098374.11e-171PREDICTED: LOB domain-containing protein 2
TrEMBLA0A022QT767e-78A0A022QT76_ERYGU; Uncharacterized protein
STRINGSolyc12g010810.1.12e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-49LOB domain-containing protein 2